PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.VT864
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family B3
Protein Properties Length: 443aa    MW: 49833.3 Da    PI: 9.2053
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.VT864genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B357.72.2e-1829115498
                  E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
           B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                  +++ps+++++  l lpk f  + +  k+ +  ++l+ + g  W++ l  + ++++ ++t GWk+Fvk++ L e+Df+vFk++g+s+f   v +f+
  Araip.VT864  29 KFMPSSYNQH--LALPKAFYGNLK--KKLPENVSLRGPGGALWNIGL--TTRDDTLYFTHGWKQFVKDHSLIENDFLVFKFNGESTF--DVLIFD 115
                  4556666555..99*****95444..558889***************..9******************************9998888..888887 PP

2B339.79e-13318402390
                  EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
           B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                   v+ p +v k+  ++lp+k + +h   ++++++++l+  +  +W  k++y + +++  l++GWk+F  +n+L+e D++vFk  g ++ 
  Araip.VT864 318 VVMRPTHVYKRFFVSLPNKWILQHI--PPRTQDIILRVVH-SEWLAKYSYHNPRNTGGLSGGWKRFTLDNNLEEYDVCVFKPGGLMNN 402
                  578899***************9995..3455678877755.69*******88888889***********************5443444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.0E-2223116IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086315.3424117IPR003340B3 DNA binding domain
CDDcd100176.86E-1926115No hitNo description
Gene3DG3DSA:2.40.330.101.7E-2226115IPR015300DNA-binding pseudobarrel domain
SMARTSM010192.4E-1627117IPR003340B3 DNA binding domain
PfamPF023625.9E-1528115IPR003340B3 DNA binding domain
CDDcd100172.08E-17315412No hitNo description
Gene3DG3DSA:2.40.330.105.0E-16315412IPR015300DNA-binding pseudobarrel domain
SMARTSM010191.1E-12316414IPR003340B3 DNA binding domain
SuperFamilySSF1019361.9E-15316403IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508639.925316414IPR003340B3 DNA binding domain
PfamPF023624.9E-11318403IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005773Cellular Componentvacuole
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 443 aa     Download sequence    Send to blast
MEGSEISHHN RSWVEDIYWN HFQFLHFAKF MPSSYNQHLA LPKAFYGNLK KKLPENVSLR  60
GPGGALWNIG LTTRDDTLYF THGWKQFVKD HSLIENDFLV FKFNGESTFD VLIFDGKNFC  120
EKAAAYFVRN VGNGNPENGV GRLTMRKDTE NSNAGVECAS PQKSVHVNSF PVPDAVPVRT  180
EPPSERNFNG DVEFSTPKQV VNVDGDAGVE VDANGVTMSE GRTRTTGKRI RKPTQAFNHF  240
QTKRRPVRVT KTSNAHKEVA NVVIDADADA DPEPVSAGKS EGGNYELYVS QRRPVTEEEM  300
NSTLQMAKAA CTDDSLCVVM RPTHVYKRFF VSLPNKWILQ HIPPRTQDII LRVVHSEWLA  360
KYSYHNPRNT GGLSGGWKRF TLDNNLEEYD VCVFKPGGLM NNTLILDVNI FRVVEEIKPL  420
TQVRASGSAK KSGKKKALKA IQI
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00468DAPTransfer from AT4G33280Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016163160.10.0PREDICTED: B3 domain-containing protein REM16 isoform X1
TrEMBLA0A0B2PTZ51e-160A0A0B2PTZ5_GLYSO; B3 domain-containing protein REM16
TrEMBLA0A0R0FTB11e-160A0A0R0FTB1_SOYBN; Uncharacterized protein
STRINGGLYMA17G36490.21e-158(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44462658
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G33280.12e-35B3 family protein